Humamised Monocolonak Antibidy

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Monoclonal Laboratories manufactures the humamised monocolonak antibidy reagents distributed by Genprice. The Humamised Monocolonak Antibidy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Humamised products are available in stock. Specificity: Humamised Category: Monocolonak Group: Antibidy

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True Blue Chloride

100 mg Ask for price

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue Diaceturate Salt

100 mg Ask for price

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Antibidy information

APOB monoconal antibody

NBP2608 each Ask for price
Description: LF EIA,CLIA

anti-Bid

YF-PA10477 100 ug
EUR 483.6
Description: Rabbit polyclonal to Bid

anti-Bid

LF-PA0182 100 ul
EUR 400.8
Description: Rabbit polyclonal to Bid

anti-Bid (8D2)

LF-MA0207 100 ul
EUR 400.8
Description: Mouse monoclonal to Bid

anti-BID (3C5)

LF-MA30561 100 ul
EUR 632.4
Description: Mouse Monoclonal to BID

anti-Bid (21F10)

LF-MA0208 100 ul
EUR 400.8
Description: Mouse monoclonal to Bid

Anti-Bid Mouse mAb

MBS475603-01mL 0.1mL
EUR 450

Anti-Bid Mouse mAb

MBS475603-5x01mL 5x0.1mL
EUR 1540

Anti-Bid (3F3-1A3)

YF-MA12124 100 ug
EUR 435.6
Description: Mouse monoclonal to Bid

Anti-Bid Antibody

A00730-1 0.1mg
EUR 449
Description: Boster Bio Anti-Bid Antibody (Catalog # A00730-1). Tested in ELISA, WB, IHC-P, IF applications. This antibody reacts with Human, Mouse.

Anti-Bid antibody

MBS176273-01mg 0.1mg
EUR 450

Anti-Bid antibody

MBS176273-5x01mg 5x0.1mg
EUR 1870

Anti-Bid Antibody

MBS176831-01mg 0.1mg
EUR 450

Anti-Bid Antibody

MBS176831-5x01mg 5x0.1mg
EUR 1870

Anti-BID Antibody

MBS8240240-003mL 0.03mL
EUR 185

Anti-BID Antibody

MBS8240240-01mL 0.1mL
EUR 255

Anti-BID Antibody

MBS8240240-02mL 0.2mL
EUR 335