Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Monoclonal Laboratories manufactures the humamised monocolonak antibidy reagents distributed by Genprice. The Humamised Monocolonak Antibidy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Humamised products are available in stock. Specificity: Humamised Category: Monocolonak Group: Antibidy
Dog True insulin ELISA kit |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog True insulin ELISA kit |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Antibidy information
APOB monoconal antibody |
NBP2608 |
Bioworld Biotech |
each |
Ask for price |
|
Description: LF EIA,CLIA |
anti-Bid |
LF-PA0182 |
Abfrontier |
100 ul |
EUR 400.8 |
Description: Rabbit polyclonal to Bid |
anti-Bid |
YF-PA10477 |
Abfrontier |
100 ug |
EUR 483.6 |
Description: Rabbit polyclonal to Bid |
anti-Bid (8D2) |
LF-MA0207 |
Abfrontier |
100 ul |
EUR 400.8 |
Description: Mouse monoclonal to Bid |
anti-BID (3C5) |
LF-MA30561 |
Abfrontier |
100 ul |
EUR 632.4 |
Description: Mouse Monoclonal to BID |
anti-Bid (21F10) |
LF-MA0208 |
Abfrontier |
100 ul |
EUR 400.8 |
Description: Mouse monoclonal to Bid |
Anti-Bid Mouse mAb |
MBS475603-01mL |
MyBiosource |
0.1mL |
EUR 450 |
Anti-Bid Mouse mAb |
MBS475603-5x01mL |
MyBiosource |
5x0.1mL |
EUR 1540 |
Anti-Bid (3F3-1A3) |
YF-MA12124 |
Abfrontier |
100 ug |
EUR 435.6 |
Description: Mouse monoclonal to Bid |
Anti-Bid Antibody |
A00730-1 |
BosterBio |
0.1mg |
EUR 449 |
|
Description: Boster Bio Anti-Bid Antibody (Catalog # A00730-1). Tested in ELISA, WB, IHC-P, IF applications. This antibody reacts with Human, Mouse. |
Anti-Bid antibody |
MBS176273-01mg |
MyBiosource |
0.1mg |
EUR 450 |
Anti-Bid antibody |
MBS176273-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1870 |
Anti-Bid Antibody |
MBS176831-01mg |
MyBiosource |
0.1mg |
EUR 450 |
Anti-Bid Antibody |
MBS176831-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1870 |
Anti-BID Antibody |
MBS8240240-003mL |
MyBiosource |
0.03mL |
EUR 185 |
Anti-BID Antibody |
MBS8240240-01mL |
MyBiosource |
0.1mL |
EUR 255 |
Anti-BID Antibody |
MBS8240240-02mL |
MyBiosource |
0.2mL |
EUR 335 |