Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the humanized monoclonal antbody reagents distributed by Genprice. The Humanized Monoclonal Antbody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Humanized products are available in stock. Specificity: Humanized Category: Monoclonal Group: Antbody
Dog True insulin ELISA kit |
|
BlueGene |
192 tests |
EUR 1524 |
|
|
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog True insulin ELISA kit |
|
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
|
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Antbody information
Humanized Monoclonal Anti-Human VEGF protein (Avastin/bevacizumab biosimilar) protein IgG1 (neutralizing) |
|
VEGF19-M |
Alpha Diagnostics |
50 ug |
EUR 578.4 |
Humanized Monoclonal Anti-Flavivirus Envelope Protein DII (EDII) IgG1 (Crossreactive with Dengue, Zika, West Nile, JEV, etc) |
|
ZENV17-M |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
Humanized Monoclonal Anti-Zika Virus Envelope Protein DIII (EDIII) IgM (non-reactive with related flavivruses; Neutralizing) |
|
ZENV16-M |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence |
|
CF813014 |
Origene Technologies GmbH |
100 µg |
Ask for price |
Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence |
|
CF813015 |
Origene Technologies GmbH |
100 µg |
Ask for price |
J695, Humanized antibody |
|
MBS156154-01mg |
MyBiosource |
0.1mg |
EUR 415 |
J695, Humanized antibody |
|
MBS156154-1mg |
MyBiosource |
1mg |
EUR 1050 |
J695, Humanized antibody |
|
MBS156154-5x1mg |
MyBiosource |
5x1mg |
EUR 4320 |
Yth12.5, Humanized antibody |
|
MBS156085-01mg |
MyBiosource |
0.1mg |
EUR 415 |
Yth12.5, Humanized antibody |
|
MBS156085-1mg |
MyBiosource |
1mg |
EUR 1055 |
Yth12.5, Humanized antibody |
|
MBS156085-5x1mg |
MyBiosource |
5x1mg |
EUR 4355 |
Yfc51.1Mab, Humanized antibody |
|
MBS156084-01mg |
MyBiosource |
0.1mg |
EUR 415 |
Yfc51.1Mab, Humanized antibody |
|
MBS156084-1mg |
MyBiosource |
1mg |
EUR 1055 |
Yfc51.1Mab, Humanized antibody |
|
MBS156084-5x1mg |
MyBiosource |
5x1mg |
EUR 4355 |
Pembrolizumab, Humanized antibody |
|
MBS156711-01mg |
MyBiosource |
0.1mg |
EUR 390 |
