Humanized Monoclonal Antbody

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the humanized monoclonal antbody reagents distributed by Genprice. The Humanized Monoclonal Antbody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Humanized products are available in stock. Specificity: Humanized Category: Monoclonal Group: Antbody

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Porcine True insulin ELISA kit

96T
EUR 700
Description: ELISA

Goat True insulin ELISA kit

96T
EUR 700
Description: ELISA

Antbody information

Humanized Monoclonal Anti-Human VEGF protein (Avastin/bevacizumab biosimilar) protein IgG1 (neutralizing)

VEGF19-M 50 ug
EUR 578.4

Humanized Monoclonal Anti-Flavivirus Envelope Protein DII (EDII) IgG1 (Crossreactive with Dengue, Zika, West Nile, JEV, etc)

ZENV17-M 100 ul
EUR 578.4

Humanized Monoclonal Anti-Zika Virus Envelope Protein DIII (EDIII) IgM (non-reactive with related flavivruses; Neutralizing)

ZENV16-M 100 ul
EUR 578.4

Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence

CF813014 100 µg Ask for price

Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence

CF813015 100 µg Ask for price

pgRNA- humanized

PVT10951 2 ug
EUR 361.2

J695, Humanized antibody

MBS156154-01mg 0.1mg
EUR 415

J695, Humanized antibody

MBS156154-1mg 1mg
EUR 1050

J695, Humanized antibody

MBS156154-5x1mg 5x1mg
EUR 4320

Yth12.5, Humanized antibody

MBS156085-01mg 0.1mg
EUR 415

Yth12.5, Humanized antibody

MBS156085-1mg 1mg
EUR 1055

Yth12.5, Humanized antibody

MBS156085-5x1mg 5x1mg
EUR 4355

Yfc51.1Mab, Humanized antibody

MBS156084-01mg 0.1mg
EUR 415

Yfc51.1Mab, Humanized antibody

MBS156084-1mg 1mg
EUR 1055

Yfc51.1Mab, Humanized antibody

MBS156084-5x1mg 5x1mg
EUR 4355

pdCas9- humanized Plasmid

PVT6322 2 ug
EUR 319.2

Pembrolizumab, Humanized antibody

MBS156711-01mg 0.1mg
EUR 390