Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Monoclonal Laboratories manufactures the human monoclonal antibodes reagents distributed by Genprice. The Human Monoclonal Antibodes reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibodes
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Antibodes information
Human CD3 Monoclonal antibody |
3CFB1-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD3 Monoclonal antibody |
3F1-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD3 Monoclonal antibody |
3PE1-100T |
ImmunoStep |
100 test |
EUR 302.5 |
Human CD3 Monoclonal antibody |
3PPC5.5-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD6 Monoclonal antibody |
6A-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD6 Monoclonal antibody |
6F-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD6 Monoclonal antibody |
6PE-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD5 Monoclonal antibody |
5A-100T |
ImmunoStep |
100 test |
EUR 276.1 |
Human CD5 Monoclonal antibody |
5A1-100T |
ImmunoStep |
100 test |
EUR 248.6 |
Human CD5 Monoclonal antibody |
5F-100T |
ImmunoStep |
100 test |
EUR 221.1 |
Human CD5 Monoclonal antibody |
5F1-100T |
ImmunoStep |
100 test |
EUR 204.6 |
Human CD5 Monoclonal antibody |
5PE1-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD5 Monoclonal antibody |
5PPC5.51-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD7 Monoclonal antibody |
7A-100T |
ImmunoStep |
100 test |
EUR 264 |
Human CD7 Monoclonal antibody |
7F-100T |
ImmunoStep |
100 test |
EUR 209 |
Human CD7 Monoclonal antibody |
7PE-100T |
ImmunoStep |
100 test |
EUR 297 |
Human CD4 Monoclonal antibody |
4A-100T |
ImmunoStep |
100 test |
EUR 259.6 |